MFF polyclonal antibody
  • MFF polyclonal antibody

MFF polyclonal antibody

Ref: AB-PAB20518
MFF polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant MFF.
Información adicional
Size 100 uL
Gene Name MFF
Gene Alias C2orf33|DKFZp666J168|GL004|MGC110913
Gene Description mitochondrial fission factor
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq RFQAPISAPEYTVTPSPQQARVCPPHMLPEDGANLSSARGILSLIQSSTRRAYQQILDVLDENRRPVLRGGSAAATSNPHHDNVRYGISNIDTTIEGTSDDLTVVDAASLRRQIIKLNRRLQLLEEENKERAKR
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human MFF.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 56947
Iso type IgG

Enviar un mensaje


MFF polyclonal antibody

MFF polyclonal antibody