GLG1 polyclonal antibody
  • GLG1 polyclonal antibody

GLG1 polyclonal antibody

Ref: AB-PAB20514
GLG1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant GLG1.
Información adicional
Size 100 uL
Gene Name GLG1
Gene Alias CFR-1|ESL-1|FLJ23319|FLJ23967|MG-160|MG160
Gene Description golgi apparatus protein 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq LDYRLDPQLQLHCSDEISSLCAEEAAAQEQTGQVEECLKVNLLKIKTELCKKEVLNMLKESKADIFVDPVLHTACALDIKHHCAAITPGRGRQMSCLMEALEDKRVRLQPECKKRLNDRIEMWSYAAKVAPADGFSDLAMQVMTSPSKNY
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human GLG1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 2734
Iso type IgG

Enviar un mensaje


GLG1 polyclonal antibody

GLG1 polyclonal antibody