B4GALT1 polyclonal antibody
  • B4GALT1 polyclonal antibody

B4GALT1 polyclonal antibody

Ref: AB-PAB20511
B4GALT1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant B4GALT1.
Información adicional
Size 100 uL
Gene Name B4GALT1
Gene Alias B4GAL-T1|DKFZp686N19253|GGTB2|GT1|GTB|MGC50983|beta4Gal-T1
Gene Description UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq FRGMSISRPNAVVGRCRMIRHSRDKKNEPNPQRFDRIAHTKETMLSDGLNSLTYQVLDVQRYPLYTQITVDIGTPS
Form Liquid
Recomended Dilution Immunohistochemistry (1:10-1:20)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human B4GALT1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 2683
Iso type IgG

Enviar un mensaje


B4GALT1 polyclonal antibody

B4GALT1 polyclonal antibody