IGSF9B polyclonal antibody
  • IGSF9B polyclonal antibody

IGSF9B polyclonal antibody

Ref: AB-PAB20510
IGSF9B polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant IGSF9B.
Información adicional
Size 100 uL
Gene Name IGSF9B
Gene Alias KIAA1030
Gene Description immunoglobulin superfamily, member 9B
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq LEAPLSSGKVSPESIRTLRAPSESSDDQGQPAAKRMLSPTREKELSLYKKTKRAISSKKYSVAKAEAEAEATTPIELISRGPDGRFVMDPAEMEPSLKSRRIEGFPFAEETDMYPEFRQSDEENEDPLVPTSVAALKSQLTPLSSSQE
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human IGSF9B.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 22997
Iso type IgG

Enviar un mensaje


IGSF9B polyclonal antibody

IGSF9B polyclonal antibody