TMEM59L polyclonal antibody
  • TMEM59L polyclonal antibody

TMEM59L polyclonal antibody

Ref: AB-PAB20505
TMEM59L polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant TMEM59L.
Información adicional
Size 100 uL
Gene Name TMEM59L
Gene Alias BSMAP|C19orf4
Gene Description transmembrane protein 59-like
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq SLLDLFSTLCNDLVNSAQGFVSSTWTYYLQTDNGKVVVFQTQPIVESLGFQGGRLQRVEVTWRGSHPEALEVHVDPVGPLDKVRKAKIRVKTSSKAKVESEEPQDNDFLSCMSR
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human TMEM59L.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 25789
Iso type IgG

Enviar un mensaje


TMEM59L polyclonal antibody

TMEM59L polyclonal antibody