FAM171B polyclonal antibody
  • FAM171B polyclonal antibody

FAM171B polyclonal antibody

Ref: AB-PAB20503
FAM171B polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant FAM171B.
Información adicional
Size 100 uL
Gene Name FAM171B
Gene Alias FLJ34104|KIAA1946
Gene Description family with sequence similarity 171, member B
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq SKQPKHINNNLSSSLGDAQDEKRYLTGNEEAYGRSHIPEQLMHIYSQPIAILQTSDLFSTPEQLHTAKSATLPRKGQLVYGQLMEPVNRENFTQTLPKMPIHSHAQPPDAREEDIILEGQQSLPSQASDWSRYS
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human FAM171B.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 165215
Iso type IgG

Enviar un mensaje


FAM171B polyclonal antibody

FAM171B polyclonal antibody