GLT8D1 polyclonal antibody
  • GLT8D1 polyclonal antibody

GLT8D1 polyclonal antibody

Ref: AB-PAB20501
GLT8D1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant GLT8D1.
Información adicional
Size 100 uL
Gene Name GLT8D1
Gene Alias AD-017|DKFZp781O20198|FLJ14611|MSTP139
Gene Description glycosyltransferase 8 domain containing 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq VPNALRHAVDGRQEEIPVVIAASEDRLGGAIAAINSIQHNTRSNVIFYIVTLNNTADHLRSWLNSDSLKSIRYKIVNFDPKLLEGKVKEDPDQGESMKPLTFARFYLPILVPSAKKAIYMDDDVIVQG
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human GLT8D1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 55830
Iso type IgG

Enviar un mensaje


GLT8D1 polyclonal antibody

GLT8D1 polyclonal antibody