GAB3 polyclonal antibody
  • GAB3 polyclonal antibody

GAB3 polyclonal antibody

Ref: AB-PAB20494
GAB3 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant GAB3.
Información adicional
Size 100 uL
Gene Name GAB3
Gene Alias -
Gene Description GRB2-associated binding protein 3
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq CTLVPRRISLSGLDNMRTWKADVEGQSLRHRDKRLSLNLPCRFSPMYPTASASIEDSYVPMSPQAGASGLGPHCSPDDYIPMNSGSISSPLPELPANLEPPPVNRDLKPQRKSRPPPLDLRNLSIIREHASLTRTRTVPCSRTSF
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human GAB3.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 139716
Iso type IgG

Enviar un mensaje


GAB3 polyclonal antibody

GAB3 polyclonal antibody