FRMD4B polyclonal antibody
  • FRMD4B polyclonal antibody

FRMD4B polyclonal antibody

Ref: AB-PAB20488
FRMD4B polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant FRMD4B.
Información adicional
Size 100 uL
Gene Name FRMD4B
Gene Alias 6030440G05Rik|GRSP1|KIAA1013
Gene Description FERM domain containing 4B
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq LRGWYQRASGQKDQGHSPQTSFDSDRGSQRCLGFAGLQVPCSPSSRASLYSSVSSTNASGNWRTQLTIGLSDYETPAHSSYTSCYGNVYNPLPSPSRQYTEISQLDGTDGN
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human FRMD4B.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 23150
Iso type IgG

Enviar un mensaje


FRMD4B polyclonal antibody

FRMD4B polyclonal antibody