SNIP polyclonal antibody
  • SNIP polyclonal antibody

SNIP polyclonal antibody

Ref: AB-PAB20487
SNIP polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SNIP.
Información adicional
Size 100 uL
Gene Name SNIP
Gene Alias KIAA1684
Gene Description SNAP25-interacting protein
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq NDLEKSVEKIQRDVSHNHRLVPGPELEEKALVLKQLGETLTELKAHFPGLQSKMRVVLRVEVEAVKFLKEEPQRLDGLLKRCRGVTDTLAQIRR
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SNIP.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 80725
Iso type IgG

Enviar un mensaje


SNIP polyclonal antibody

SNIP polyclonal antibody