LHPP polyclonal antibody
  • LHPP polyclonal antibody

LHPP polyclonal antibody

Ref: AB-PAB20479
LHPP polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant LHPP.
Información adicional
Size 100 uL
Gene Name LHPP
Gene Alias MGC117251|MGC142189|MGC142191
Gene Description phospholysine phosphohistidine inorganic pyrophosphate phosphatase
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq SGVLYDSGAGGGTAIAGSVEAVARLKRSRLKVRFCTNESQKSRAELVGQLQRLGFDISEQEVTAPAPAACQILKERGLRPYLLIHDGVRSEFDQIDTSNPNCVVIADAGE
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human LHPP.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 64077
Iso type IgG

Enviar un mensaje


LHPP polyclonal antibody

LHPP polyclonal antibody