COMMD9 polyclonal antibody
  • COMMD9 polyclonal antibody

COMMD9 polyclonal antibody

Ref: AB-PAB20476
COMMD9 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant COMMD9.
Información adicional
Size 100 uL
Gene Name COMMD9
Gene Alias FLJ31106|HSPC166
Gene Description COMM domain containing 9
Storage Conditions Store at 4ºC. For long term storage store at -20ºC.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq KLLDVTCSSLSVTQEEAEELLQALHRLTRLVAFRDLSSAEAILALFPENFHQNLKNLLTKIILEHVSTWRTEAQANQISLPRLVDLDWRVDIKTSSDSISRMAVPTCLLQMKIQEDPSLCGDKPSISAVTV
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human COMMD9.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 29099
Iso type IgG

Enviar un mensaje


COMMD9 polyclonal antibody

COMMD9 polyclonal antibody