C20orf26 polyclonal antibody
  • C20orf26 polyclonal antibody

C20orf26 polyclonal antibody

Ref: AB-PAB20473
C20orf26 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant C20orf26.
Información adicional
Size 100 uL
Gene Name C20orf26
Gene Alias DKFZp434K156|dJ1002M8.3|dJ1178H5.4
Gene Description chromosome 20 open reading frame 26
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq HMKFNNLTLISTHGLPGKKLLDTEQRKFLASDHCFNDKDYALMSLCSWVNVVVGRMTGIDRAAKHVVLSTDEIVPYDHLILCTGQQYQVPCPTEADISQHLTNREVPNSSQRRYTGKVPCNHFTLNEEEDCFKALIWIRNNSITTE
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human C20orf26.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 26074
Iso type IgG

Enviar un mensaje


C20orf26 polyclonal antibody

C20orf26 polyclonal antibody