SPINK5 polyclonal antibody
  • SPINK5 polyclonal antibody

SPINK5 polyclonal antibody

Ref: AB-PAB20471
SPINK5 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SPINK5.
Información adicional
Size 100 uL
Gene Name SPINK5
Gene Alias DKFZp686K19184|FLJ21544|FLJ97536|FLJ97596|FLJ99794|LEKTI|LETKI|NETS|NS|VAKTI
Gene Description serine peptidase inhibitor, Kazal type 5
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq DGRLGCTRENDPVLGPDGKTHGNKCAMCAELFLKEAENAKREGETRIRRNAEKDFCKEYEKQVRNGRLFCTRESDPVRGPDGRMHGNKCALCAEIFKQRFSEENSKTDQN
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SPINK5.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 11005
Iso type IgG

Enviar un mensaje


SPINK5 polyclonal antibody

SPINK5 polyclonal antibody