PRRG4 polyclonal antibody
  • PRRG4 polyclonal antibody

PRRG4 polyclonal antibody

Ref: AB-PAB20468
PRRG4 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant PRRG4.
Información adicional
Size 100 uL
Gene Name PRRG4
Gene Alias PRGP4|TMG4
Gene Description proline rich Gla (G-carboxyglutamic acid) 4 (transmembrane)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq NRLQHPCSSAVYERGRHTPSIIFRRPEEAALSPLPPSVEDAGLPSYEQAVALTRKHSVSPPPPYPGHTKGFRVFKKSMSLPSH
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human PRRG4.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 79056
Iso type IgG

Enviar un mensaje


PRRG4 polyclonal antibody

PRRG4 polyclonal antibody