ENDOD1 polyclonal antibody Ver mas grande

ENDOD1 polyclonal antibody

AB-PAB20461

Producto nuevo

ENDOD1 polyclonal antibody

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 6 Biopuntos. Su cesta contiene un total 6 Biopuntos puede ser convertido en un Biobonos Descuento 24.00EUR.


Hoja técnica

Size 100 uL
Gene Name ENDOD1
Gene Alias KIAA0830|MGC88092
Gene Description endonuclease domain containing 1
Storage Conditions Store at 4ºC. For long term storage store at -20ºC.<br>Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq SGEDLYILTGTVPSDYRVKDKVAVPEFVWLAACCAVPGGGWAMGFVKHTRDSDIIEDVMVKDLQKLLPFNPQLFQNNCGETEQDTEKMKKILEVVNQIQDEERMVQSQKSSSPLSSTRSKRSTLLPPEASEGSSSFLGKLMGFIATPF
Form Liquid
Recomended Dilution Immunohistochemistry (1:1000-1:2500)<br>The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ENDOD1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 23052
Iso type IgG

Más información

Rabbit polyclonal antibody raised against recombinant ENDOD1.

Consulta sobre un producto

ENDOD1 polyclonal antibody

ENDOD1 polyclonal antibody