FLII polyclonal antibody
  • FLII polyclonal antibody

FLII polyclonal antibody

Ref: AB-PAB20459
FLII polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant FLII.
Información adicional
Size 100 uL
Gene Name FLII
Gene Alias FLI|FLIL|Fli1|MGC39265
Gene Description flightless I homolog (Drosophila)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB,IHC-P,IF
Immunogen Prot. Seq YILDCWSDVFIWLGRKSPRLVRAAALKLGQELCGMLHRPRHATVSRSLEGTEAQVFKAKFKNWDDVLTVDYTRNAEAVLQSPGLSGKVKRDAEKKDQMKADLTALFLPRQPPMSLAEAEQLMEEWNEDL
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human FLII.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 2314
Iso type IgG

Enviar un mensaje


FLII polyclonal antibody

FLII polyclonal antibody