ME2 polyclonal antibody
  • ME2 polyclonal antibody

ME2 polyclonal antibody

Ref: AB-PAB20457
ME2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ME2.
Información adicional
Size 100 uL
Gene Name ME2
Gene Alias -
Gene Description malic enzyme 2, NAD(+)-dependent, mitochondrial
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P,IF
Immunogen Prot. Seq KVISKPISEHKILFLGAGEAALGIANLIVMSMVENGLSEQEAQKKIWMFDKYGLLVKGRKAKIDSYQEPFTHSAPESIPDTFEDAVNILKPSTIIGVAGAGRLFTPDVIRAMASINERPVIFALSNPTA
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
Western Blot (1:250-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ME2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 4200
Iso type IgG

Enviar un mensaje


ME2 polyclonal antibody

ME2 polyclonal antibody