LONP2 polyclonal antibody
  • LONP2 polyclonal antibody

LONP2 polyclonal antibody

Ref: AB-PAB20455
LONP2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant LONP2.
Información adicional
Size 100 uL
Gene Name LONP2
Gene Alias LONP|LONPL|MGC4840
Gene Description lon peptidase 2, peroxisomal
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq TILGVIPNTPDPASDAQDLPPLHRIGTAALAVQVVGSNWPKPHYTLLITGLCRFQIVQVLKEKPYPIAEVEQLDRLEEFPNTCKMREELGELSEQFYKYAVQLVEMLDMSVPAVAKLRR
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human LONP2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 83752
Iso type IgG

Enviar un mensaje


LONP2 polyclonal antibody

LONP2 polyclonal antibody