TSHZ3 polyclonal antibody
  • TSHZ3 polyclonal antibody

TSHZ3 polyclonal antibody

Ref: AB-PAB20452
TSHZ3 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant TSHZ3.
Información adicional
Size 100 uL
Gene Name TSHZ3
Gene Alias FLJ54422|KIAA1474|TSH3|ZNF537
Gene Description teashirt zinc finger homeobox 3
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq TNFHAMEELVKKVTEKVAKVEEKMKEPDGKLSPPKRATPSPCSSEVGEPIKMEASSDGGFRSQENSPSPPRDGCKDGSPLAEPVENGKELVKPLASSLSGSTAIITDHP
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human TSHZ3.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 57616
Iso type IgG

Enviar un mensaje


TSHZ3 polyclonal antibody

TSHZ3 polyclonal antibody