UXS1 polyclonal antibody
  • UXS1 polyclonal antibody

UXS1 polyclonal antibody

Ref: AB-PAB20451
UXS1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant UXS1.
Información adicional
Size 100 uL
Gene Name UXS1
Gene Alias FLJ23591|SDR6E1|UGD
Gene Description UDP-glucuronate decarboxylase 1
Storage Conditions Store at 4ºC. For long term storage store at -20ºC.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq MRSIQENGELKIESKIEEMVEPLREKIRDLEKSFTQKYPPVKFLSEKDRKRILITGGAGFVGSHLTDKLMMDGHEVTVVDNFFTGRKRNVEHWIGHENFELINHDV
Form Liquid
Recomended Dilution Immunohistochemistry
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human UXS1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 80146
Iso type IgG

Enviar un mensaje


UXS1 polyclonal antibody

UXS1 polyclonal antibody