KIAA0907 polyclonal antibody
  • KIAA0907 polyclonal antibody

KIAA0907 polyclonal antibody

Ref: AB-PAB20449
KIAA0907 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant KIAA0907.
Información adicional
Size 100 uL
Gene Name KIAA0907
Gene Alias RP11-336K24.1
Gene Description KIAA0907
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq KGKLKPTQNASEKLQAPGKGLTSNKSKDDLVVAEVEINDVPLTCRNLLTRGQTQDEISRLSGAAVSTRGRFMTTEEKAKVGPGDRPLYLHVQGQTRELVDRAVNRIKEIITNGVVKAATGTSPTFNGATVTVYHQPAP
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human KIAA0907.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 22889
Iso type IgG

Enviar un mensaje


KIAA0907 polyclonal antibody

KIAA0907 polyclonal antibody