MRPL9 polyclonal antibody
  • MRPL9 polyclonal antibody

MRPL9 polyclonal antibody

Ref: AB-PAB20438
MRPL9 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant MRPL9.
Información adicional
Size 100 uL
Gene Name MRPL9
Gene Alias L9mt
Gene Description mitochondrial ribosomal protein L9
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P,IF
Immunogen Prot. Seq NAPDLACNFSLSQNRGTVIVERWWKVPLAGEGRKPRLHRRHRVYKLVEDTKHRPKENLELILTQSVENVGVRGDLVSVKKSLGRNRLLPQGLAVYASPENKKLFEEEKLLRQEGKLEKIQTKAGEATVKFLKSCRLEVGMKNNV
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human MRPL9.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 65005
Iso type IgG

Enviar un mensaje


MRPL9 polyclonal antibody

MRPL9 polyclonal antibody