CCDC23 polyclonal antibody
  • CCDC23 polyclonal antibody

CCDC23 polyclonal antibody

Ref: AB-PAB20433
CCDC23 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant CCDC23.
Información adicional
Size 100 uL
Gene Name CCDC23
Gene Alias -
Gene Description coiled-coil domain containing 23
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq DPPARKEKTKVKESVSRVEKAKQKSAQQELKQRQRAEIYALNRVMTELEQQQFDEFCKQMQPPGE
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human CCDC23.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 374969
Iso type IgG

Enviar un mensaje


CCDC23 polyclonal antibody

CCDC23 polyclonal antibody