KLHDC8B polyclonal antibody
  • KLHDC8B polyclonal antibody

KLHDC8B polyclonal antibody

Ref: AB-PAB20431
KLHDC8B polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant KLHDC8B.
Información adicional
Size 100 uL
Gene Name KLHDC8B
Gene Alias FLJ11302|MGC35097
Gene Description kelch domain containing 8B
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P,IF
Immunogen Prot. Seq GTVAHQDGHLLVLGGCGRAGLPLDTAETLDMASHTWLALAPLPTARAGAAAVVLGKQVLVVGGVDEVQSPVAAVEAFLMDEGRWERRATLPQAAMGVATVERDGMVYALG
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
Western Blot (1:250-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human KLHDC8B.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 200942
Iso type IgG

Enviar un mensaje


KLHDC8B polyclonal antibody

KLHDC8B polyclonal antibody