FAM98B polyclonal antibody
  • FAM98B polyclonal antibody

FAM98B polyclonal antibody

Ref: AB-PAB20420
FAM98B polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant FAM98B.
Información adicional
Size 100 uL
Gene Name FAM98B
Gene Alias FLJ38426
Gene Description family with sequence similarity 98, member B
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq STTSDIPHMLNQVESKVKDILSKVQKNHVGKPLLKMDLNSEQAEQLERINDALSCEYECRRRMLMKRLDVTVQSFGWSDRAKVKTDDIARIYQPKRYALSPKTTITMAHLLAAREDLSKIIRTSSGTSREKTACAI
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human FAM98B.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 283742
Iso type IgG

Enviar un mensaje


FAM98B polyclonal antibody

FAM98B polyclonal antibody