C1orf174 polyclonal antibody
  • C1orf174 polyclonal antibody

C1orf174 polyclonal antibody

Ref: AB-PAB20418
C1orf174 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant C1orf174.
Información adicional
Size 100 uL
Gene Name C1orf174
Gene Alias RP13-531C17.2
Gene Description chromosome 1 open reading frame 174
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq VSDSRLAKTRDGLSVPKHSAGSGAEESNSSSTVQKQNEPGLQTEDVQKPPLQMDNSVFLDDDSNQPMPVSRFFGNVELMQDLPPASSSCPSMSRREFRKMHFRAKDDDDDDDDD
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human C1orf174.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 339448
Iso type IgG

Enviar un mensaje


C1orf174 polyclonal antibody

C1orf174 polyclonal antibody