SEC23B polyclonal antibody
  • SEC23B polyclonal antibody

SEC23B polyclonal antibody

Ref: AB-PAB20415
SEC23B polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SEC23B.
Información adicional
Size 100 uL
Gene Name SEC23B
Gene Alias -
Gene Description Sec23 homolog B (S. cerevisiae)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq MVQVHELSCEGISKSYVFRGTKDLTAKQIQDMLGLTKPAMPMQQARPAQPQEHPFASSRFLQPVHKIDMNLTDLLGELQRDPWPVTQGKRPLRSTGV
Form Liquid
Recomended Dilution Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SEC23B.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 10483
Iso type IgG

Enviar un mensaje


SEC23B polyclonal antibody

SEC23B polyclonal antibody