NGEF polyclonal antibody
  • NGEF polyclonal antibody

NGEF polyclonal antibody

Ref: AB-PAB20411
NGEF polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant NGEF.
Información adicional
Size 100 uL
Gene Name NGEF
Gene Alias EPHEXIN
Gene Description neuronal guanine nucleotide exchange factor
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq METRESEDLEKTRRKSASDQWNTDNEPAKVKPELLPEKEETSQADQDIQDKEPHCHIPIKRNSIFNRSIRRKSKAKARDNPERNASCLADSQDNGKSVNEPLTLNIPWSRTPPCRTAMQTDPGAQEMSESSST
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human NGEF.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 25791
Iso type IgG

Enviar un mensaje


NGEF polyclonal antibody

NGEF polyclonal antibody