RNF43 polyclonal antibody
  • RNF43 polyclonal antibody

RNF43 polyclonal antibody

Ref: AB-PAB20409
RNF43 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant RNF43.
Información adicional
Size 100 uL
Gene Name RNF43
Gene Alias DKFZp781H02126|DKFZp781H0392|FLJ20315|FLJ77466|FLJ99338|MGC125630|RNF124|URCC
Gene Description ring finger protein 43
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq CVDPWLHQHRTCPLCMFNITEGDSFSQSLGPSRSYQEPGRRLHLIRQHPGHAHYHLPAAYLLGPSRSAVARPPRPGPFLPSQEPGMGPRHHRFPRAAHPRAPGEQQRLAGAQHPYAQGWGLSHLQSTSQH
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human RNF43.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 54894
Iso type IgG

Enviar un mensaje


RNF43 polyclonal antibody

RNF43 polyclonal antibody