LY6G6F polyclonal antibody
  • LY6G6F polyclonal antibody

LY6G6F polyclonal antibody

Ref: AB-PAB20407
LY6G6F polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant LY6G6F.
Información adicional
Size 100 uL
Gene Name LY6G6F
Gene Alias C6orf21|G6f|LY6G6D|NG32
Gene Description lymphocyte antigen 6 complex, locus G6F
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq LLGNYSLWLEGSKEEDAGRYWCAVLGQHHNYQNWRVYDVLVLKGSQLSARAADGSPCNVLLCSVVPSRRMDSVTWQEGKGPVRGRVQSFWGSEAALLLVCPGEGLSEPRSRRPRIIRCLMTHNKGVSFSLAASIDASPAL
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human LY6G6F.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 259215
Iso type IgG

Enviar un mensaje


LY6G6F polyclonal antibody

LY6G6F polyclonal antibody