CLIC4 polyclonal antibody
  • CLIC4 polyclonal antibody

CLIC4 polyclonal antibody

Ref: AB-PAB20406
CLIC4 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant CLIC4.
Información adicional
Size 100 uL
Gene Name CLIC4
Gene Alias CLIC4L|DKFZp566G223|FLJ38640|H1|MTCLIC|huH1|p64H1
Gene Description chloride intracellular channel 4
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P,IF
Immunogen Prot. Seq THPPFITFNSEVKTDVNKIEEFLEEVLCPPKYLKLSPKHPESNTAGMDIFAKFSAYIKNSRPEANEALERGLLKTLQKLDEYLNSPLPDEIDENSMEDIKFSTRKFLDGNEMTLADCNLLPKLHIVKVVAKKYRNFDIPKEMTGI
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
Western Blot (1:250-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human CLIC4.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 25932
Iso type IgG

Enviar un mensaje


CLIC4 polyclonal antibody

CLIC4 polyclonal antibody