A4GNT polyclonal antibody
  • A4GNT polyclonal antibody

A4GNT polyclonal antibody

Ref: AB-PAB20405
A4GNT polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant A4GNT.
Información adicional
Size 100 uL
Gene Name A4GNT
Gene Alias MGC149493|alpha4GnT
Gene Description alpha-1,4-N-acetylglucosaminyltransferase
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq NFVEHYNSAIWGNQGPELMTRMLRVWCKLEDFQEVSDLRCLNISFLHPQRFYPISYREWRRYYEVWDTEPSFNVSYALHLWNHMNQEGRAVIRGSNTLVENLYRKHCPRTYRDLIKGPEGSVTGELG
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human A4GNT.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 51146
Iso type IgG

Enviar un mensaje


A4GNT polyclonal antibody

A4GNT polyclonal antibody