LRPAP1 polyclonal antibody
  • LRPAP1 polyclonal antibody

LRPAP1 polyclonal antibody

Ref: AB-PAB20404
LRPAP1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant LRPAP1.
Información adicional
Size 100 uL
Gene Name LRPAP1
Gene Alias A2MRAP|A2RAP|HBP44|MGC138272|MRAP|RAP
Gene Description low density lipoprotein receptor-related protein associated protein 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB,IHC-P,IF
Immunogen Prot. Seq RMEKLNQLWEKAQRLHLPPVRLAELHADLKIQERDELAWKKLKLDGLDEDGEKEARLIRNLNVILAKYGLDGKKDARQVTSNSLSGTQEDGLDDPRLEKLWHKAKTSGKFSGEELDKLWREFLHHKEK
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human LRPAP1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 4043
Iso type IgG

Enviar un mensaje


LRPAP1 polyclonal antibody

LRPAP1 polyclonal antibody