MAGI3 polyclonal antibody
  • MAGI3 polyclonal antibody

MAGI3 polyclonal antibody

Ref: AB-PAB20398
MAGI3 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant MAGI3.
Información adicional
Size 100 uL
Gene Name MAGI3
Gene Alias MAGI-3|MGC163281|RP4-730K3.1|dJ730K3.2
Gene Description membrane associated guanylate kinase, WW and PDZ domain containing 3
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq LKVGDHISAVNGQSIVELSHDNIVQLIKDAGVTVTLTVIAEEEHHGPPSGTNSARQSPALQHRPMGQSQANHIPGDRSALEGEIGKDVSTSYRHSWSDHKHLAQPDTAVISVVGSRHNQNLGCYPVELERGPRGFGFSLRG
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human MAGI3.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 260425
Iso type IgG

Enviar un mensaje


MAGI3 polyclonal antibody

MAGI3 polyclonal antibody