FER polyclonal antibody
  • FER polyclonal antibody

FER polyclonal antibody

Ref: AB-PAB20388
FER polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant FER.
Información adicional
Size 100 uL
Gene Name FER
Gene Alias TYK3
Gene Description fer (fps/fes related) tyrosine kinase
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P,IF
Immunogen Prot. Seq QVMLKTLAEELMQTQQMLLNKEEAVLELEKRIEESSETCEKKSDIVLLLSQKQALEELKQSVQQLRCTEAKFSAQKELLEQKVQENDGKEPPPVVNYEEDARSVTSMERKERLSKFESIRHSIAGIIRSPKS
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human FER.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 2241
Iso type IgG

Enviar un mensaje


FER polyclonal antibody

FER polyclonal antibody