JMJD2A polyclonal antibody
  • JMJD2A polyclonal antibody

JMJD2A polyclonal antibody

Ref: AB-PAB20387
JMJD2A polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant JMJD2A.
Información adicional
Size 100 uL
Gene Name JMJD2A
Gene Alias JHDM3A|JMJD2|KDM4A|KIAA0677
Gene Description jumonji domain containing 2A
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P,IF
Immunogen Prot. Seq DVFVRKFQPERYKLWKAGKDNTVIDHTLPTPEAAEFLKESELPPRAGNEEECPEEDMEGVEDGEEGDLKTSLAKHRIGTKRHRVCLEIPQEVSQSELFPKEDLSSEQYEMTEC
Form Liquid
Recomended Dilution Western Blot (1:250-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human JMJD2A.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 9682
Iso type IgG

Enviar un mensaje


JMJD2A polyclonal antibody

JMJD2A polyclonal antibody