ULBP1 polyclonal antibody
  • ULBP1 polyclonal antibody

ULBP1 polyclonal antibody

Ref: AB-PAB20384
ULBP1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ULBP1.
Información adicional
Size 100 uL
Gene Name ULBP1
Gene Alias RAET1I
Gene Description UL16 binding protein 1
Storage Conditions Store at 4ºC. For long term storage store at -20ºC.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq THCLCYDFIITPKSRPEPQWCEVQGLVDERPFLHYDCVNHKAKAFASLGKKVNVTKTWEEQTETLRDVVDFLKGQLLDIQVENLIPIEPLTLQARMS
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ULBP1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 80329
Iso type IgG

Enviar un mensaje


ULBP1 polyclonal antibody

ULBP1 polyclonal antibody