RCOR3 polyclonal antibody
  • RCOR3 polyclonal antibody

RCOR3 polyclonal antibody

Ref: AB-PAB20379
RCOR3 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant RCOR3.
Información adicional
Size 100 uL
Gene Name RCOR3
Gene Alias FLJ10876|FLJ16298|RP11-318L16.1
Gene Description REST corepressor 3
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq RSRTSLMDRQARKLANRHNQGDSDDDVEETHPMDGNDSDYDPKKEAKKEGNTEQPVQTSKIGLGRREYQSLQHRHHSQRSKCRPPKGMYLTQEDVVAVSCSPNAANT
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human RCOR3.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 55758
Iso type IgG

Enviar un mensaje


RCOR3 polyclonal antibody

RCOR3 polyclonal antibody