ZNF397OS polyclonal antibody
  • ZNF397OS polyclonal antibody

ZNF397OS polyclonal antibody

Ref: AB-PAB20370
ZNF397OS polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ZNF397OS.
Información adicional
Size 100 uL
Gene Name ZNF397OS
Gene Alias FLJ16245|FLJ46864
Gene Description zinc finger protein 397 opposite strand
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq QLPSQDRHFSLATFNRRIPTEHSVLESHESEGSFSMNSNDITQQSVDTREKLYECFDCGKAFCQSSKLIRHQRIHTGERPYACKECGKAFSLSSDLVRHQRIHSGE
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ZNF397OS.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 100101467
Iso type IgG

Enviar un mensaje


ZNF397OS polyclonal antibody

ZNF397OS polyclonal antibody