FAM198B polyclonal antibody
  • FAM198B polyclonal antibody

FAM198B polyclonal antibody

Ref: AB-PAB20367
FAM198B polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant FAM198B.
Información adicional
Size 100 uL
Gene Name FAM198B
Gene Alias AD021|AD036|DKFZp434L142|FLJ23966|FLJ38155|C4orf18
Gene Description family with sequence similarity 198 member B
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq PRTRRNLLLGTACAIYLGFLVSQVGRASLQHGQAAEKGPHRSRDTAEPSFPEIPLDGTLAPPESQGNGSTLQPNVVYITLRSKRSKPANIRGTVKPKRRKKHAVASAAPGQEALVGPSLQPQEAAREADAVAPGYA
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human FAM198B.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 51313
Iso type IgG

Enviar un mensaje


FAM198B polyclonal antibody

FAM198B polyclonal antibody