RDBP polyclonal antibody
  • RDBP polyclonal antibody

RDBP polyclonal antibody

Ref: AB-PAB20363
RDBP polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant RDBP.
Información adicional
Size 100 uL
Gene Name RDBP
Gene Alias D6S45|NELF-E|RD|RDP
Gene Description RD RNA binding protein
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P,IF
Immunogen Prot. Seq LLALKKQSSSSTTSQGGVKRSLSEQPVMDTATATEQAKQLVKSGAISAIKAETKNSGFKRSRTLEGKLKDPEKGPVPTFQPFQRSISADDDLQESSRRPQRKSLYESFVSSSDRLRELGPDG
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human RDBP.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 7936
Iso type IgG

Enviar un mensaje


RDBP polyclonal antibody

RDBP polyclonal antibody