GPR114 polyclonal antibody
  • GPR114 polyclonal antibody

GPR114 polyclonal antibody

Ref: AB-PAB20360
GPR114 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant GPR114.
Información adicional
Size 100 uL
Gene Name GPR114
Gene Alias PGR27
Gene Description G protein-coupled receptor 114
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq ETWEELLSYMENMQVSRGRSSVFSSRQLHQLEQMLLNTSFPGYNLTLQTPTIQSLAFKLSCDFSGLSLTSATLKRVPQAGGQHARGQHAMQFPAELTRDACKTRPRELRLICIYFSNTHFFKDENNSSLLNNYVLGAQLSHGHVNNLRD
Form Liquid
Recomended Dilution Immunohistochemistry (1:10-1:20)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human GPR114.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 221188
Iso type IgG

Enviar un mensaje


GPR114 polyclonal antibody

GPR114 polyclonal antibody