KANSL1 polyclonal antibody
  • KANSL1 polyclonal antibody

KANSL1 polyclonal antibody

Ref: AB-PAB20355
KANSL1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant KANSL1.
Información adicional
Size 100 uL
Gene Name KANSL1
Gene Alias CENP-36|KDVS|KIAA1267|MSL1v1|NSL1|hMSL1v1
Gene Description KAT8 regulatory NSL complex subunit 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq APLLERLSQLDSCVHPVLAFPDDVPTSLHFQSMLKSQWQNKPFDKIKPPKKLSLKHRAPMPGSLPDSARKDRHKLVSSFLTTAKLSHHQTRPDRTHRQHLDDVGAVPMVERVTAPKAERLLNPPPPVHDPNHSKMRLRDHSS
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human KANSL1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 284058
Iso type IgG

Enviar un mensaje


KANSL1 polyclonal antibody

KANSL1 polyclonal antibody