FADS2 polyclonal antibody
  • FADS2 polyclonal antibody

FADS2 polyclonal antibody

Ref: AB-PAB20354
FADS2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant FADS2.
Información adicional
Size 100 uL
Gene Name FADS2
Gene Alias D6D|DES6|FADSD6|LLCDL2|SLL0262|TU13
Gene Description fatty acid desaturase 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq GKGGNQGEGAAEREVSVPTFSWEEIQKHNLRTDRWLVIDRKVYNITKWSIQHPGGQRVIGHYAGEDATDAFRAFHPDLEFVGKFLKPLLIGELAPEEPSQDHGKNSKITEDFRALRKTAEDMNLFKTNH
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human FADS2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 9415
Iso type IgG

Enviar un mensaje


FADS2 polyclonal antibody

FADS2 polyclonal antibody