ITLN2 polyclonal antibody
  • ITLN2 polyclonal antibody

ITLN2 polyclonal antibody

Ref: AB-PAB20353
ITLN2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ITLN2.
Información adicional
Size 100 uL
Gene Name ITLN2
Gene Alias HL-2|HL2
Gene Description intelectin 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq TCAFSFSSLPRSCKEIKERCHSAGDGLYFLRTKNGVVY
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ITLN2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 142683
Iso type IgG

Enviar un mensaje


ITLN2 polyclonal antibody

ITLN2 polyclonal antibody