PPP1R13B polyclonal antibody
  • PPP1R13B polyclonal antibody

PPP1R13B polyclonal antibody

Ref: AB-PAB20346
PPP1R13B polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant PPP1R13B.
Información adicional
Size 100 uL
Gene Name PPP1R13B
Gene Alias ASPP1|KIAA0771|p53BP2-like|p85
Gene Description protein phosphatase 1, regulatory (inhibitor) subunit 13B
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB,IHC-P,IF
Immunogen Prot. Seq PNIQKLLYQRFNTLAGGMEGTPFYQPSPSQDFMGTLADVDNGNTNANGNLEELPPAQPTAPLPAEPAPSSDANDNELPSPEPEELICPQTTHQTAEPAEDNNNNVATVPTTEQIPSPVAEAPSPGEEQVPPAPLPPASHPPATSTNK
Form Liquid
Recomended Dilution Western Blot (1:250-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human PPP1R13B.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 23368
Iso type IgG

Enviar un mensaje


PPP1R13B polyclonal antibody

PPP1R13B polyclonal antibody