RBM47 polyclonal antibody
  • RBM47 polyclonal antibody

RBM47 polyclonal antibody

Ref: AB-PAB20345
RBM47 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant RBM47.
Información adicional
Size 100 uL
Gene Name RBM47
Gene Alias DKFZp686F02235|FLJ20273|FLJ21344|FLJ21643
Gene Description RNA binding motif protein 47
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq HAMNNLNGTELEGSCLEVTLAKPVDKEQYSRYQKAARGGGAAEAAQQPSYVYSCDPYTLAYYGYPYNALIGPNRDYFVKAGSIRGRGRGAAGNRAPGPRGSYLGGYSAGRGIYSRYHEGKGKQQEKGYELVPNLEIPTVN
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human RBM47.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 54502
Iso type IgG

Enviar un mensaje


RBM47 polyclonal antibody

RBM47 polyclonal antibody