RPS12 polyclonal antibody
  • RPS12 polyclonal antibody

RPS12 polyclonal antibody

Ref: AB-PAB20339
RPS12 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant RPS12.
Información adicional
Size 100 uL
Gene Name RPS12
Gene Alias -
Gene Description ribosomal protein S12
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq AAGGVMDVNTALQEVLKTALIHDGLARGIREAAKALDKRQAHLCVLASNCDEPMYVKLVEALCAEHQINLIKVDDNKKLGEWVGLCKIDREGKPRKVVGCSCVVVKDYGKESQAKDV
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human RPS12.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 6206
Iso type IgG

Enviar un mensaje


RPS12 polyclonal antibody

RPS12 polyclonal antibody