SCIMP polyclonal antibody
  • SCIMP polyclonal antibody

SCIMP polyclonal antibody

Ref: AB-PAB20338
SCIMP polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SCIMP.
Información adicional
Size 100 uL
Gene Name SCIMP
Gene Alias UNQ5783/PRO16090|C17orf87|UNQ5783
Gene Description SLP adaptor and CSK interacting membrane protein
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq RRGKKWEIAKPLKHKQVDEEKMYENVLNESPVQLPPLPPRNWPSLEDSSPQEAPSQPPATYSLVNKVKNKKTVSIPSYIEPEDDYDDVEIPANTE
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SCIMP.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 388325
Iso type IgG

Enviar un mensaje


SCIMP polyclonal antibody

SCIMP polyclonal antibody